SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UI89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UI89
Domain Number 1 Region: 21-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-71
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 402-517
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.15e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 262-367
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 599-718
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.39e-25
Family Ankyrin repeat 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UI89
Sequence length 768
Comment (tr|G3UI89|G3UI89_LOXAF) ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 {ECO:0000313|Ensembl:ENSLAFP00000027547} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ACAP2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
YRFSLHTMECFCKRQPTYSSAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQ
FMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLR
KFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQIN
VLQSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDQLVVDAAKEKREM
EQKHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVY
QKKFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQT
SIATAYRDKSDESEKLDKKSSPSTGSLESGSESKEKLLKGESALQRVQCIPGNASCCDCG
LADPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRV
YEAKVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYAISASPPEQEEKTVSKSCEEKR
LSISKPGPVRSNDSGIQQSSDDGRESLPSMVSANSLYEPEGERQDSAFLDSKHLNPGLQL
YRASYEKNLPKMAEALAHGADVNWANLEENQATPLIQAVLGGSLVTCEFLLQNGANVNQR
DVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLTIAVEAANADIVTLLRLAR
MNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQESQKF
Download sequence
Identical sequences G3UI89
ENSLAFP00000027547 ENSLAFP00000014316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]