SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UJD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UJD1
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-62
Family SPRY domain 0.0000000272
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000194
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UJD1
Sequence length 273
Comment (tr|G3UJD1|G3UJD1_LOXAF) SplA/ryanodine receptor domain and SOCS box containing 4 {ECO:0000313|Ensembl:ENSLAFP00000027939} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SPSB4 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MGQKLSGSLKSVEVREPALRPAKRELRGAEPGQPARLDQLLDMPAAGLAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIAARWGPPPGLHPWEVHLAGRQRGTHAVVGVATA
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNRPGVAYPAFLGPDEAFALPDSLLVV
LDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRTIRSALGRQHLRDIGSLPLPQSLKNYLQYQ
Download sequence
Identical sequences G3UJD1
ENSLAFP00000027939 ENSLAFP00000027939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]