SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UJK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UJK1
Domain Number 1 Region: 624-786
Classification Level Classification E-value
Superfamily PH domain-like 5.62e-55
Family Pleckstrin-homology domain (PH domain) 0.0000147
Further Details:      
 
Domain Number 2 Region: 414-627
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-53
Family DBL homology domain (DH-domain) 0.0000000949
Further Details:      
 
Domain Number 3 Region: 189-298
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000253
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UJK1
Sequence length 1025
Comment (tr|G3UJK1|G3UJK1_LOXAF) T-cell lymphoma invasion and metastasis 2 {ECO:0000313|Ensembl:ENSLAFP00000028010} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TIAM2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
QIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSF
HALICSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKEKRPSITQVDELLPIY
GSTADGVRRDSTWETQAYVHFQDNQGVTVMIKPEHRVEDILTLACKMRQLEPSHYGLRLR
KLVDENSEWYSPTLHEYMQDQAYEEIEIFPLNVRAVQLAKTGSVPDFGFAVTAQVDEHQH
LSRIFISDVLPDGLAYGEGLRKGNEIVTLNGEAVADLNLKQMEALFSEKSVGLTLVARPL
DAKRTLGTSWSDSDLFSTDQKRLLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKR
SQTDGTLDQVSHREKMEQTFRSAEQIAALCRGFTDTQTGDMEAPRESRDAPPRPLARHLS
DADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQSETFLTQDEMESLFGSLPEMLEFQK
VFLETLEDGISASSDFNTLETPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVL
ERAKTDQAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLKELVSLTDHESEEHYH
LTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKELAESSPFRLGPHENFSWR
LARLVEGRIEKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHGSADLDPFKFRWLI
PLSALQVRLGNTAGTENNSLWELIHTKSEVEGRPETTFQLCCSDCESKTNIVKVIRSILR
ENFRRHIKCDLPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLRNSSSSEGMGEPSKGTS
LDSDDGSLGSSTQSSGCHTAESRQDSKSASPVKCPPASLSEFSDSLIKESDILSDEEDDY
QPALKRGSPTKDIEIQFQRLRISEEPDARPAGQPPGTQAREGQQGGEHPKLIRGHFCPIK
RKANSTKRDRGTLLKSQVRHQSLDSQSENAHIDINSVLQREFSVQSLTSVVNEECFYEAE
GHGKS
Download sequence
Identical sequences G3UJK1
ENSLAFP00000028010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]