SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UKU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UKU8
Domain Number 1 Region: 82-275
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.54e-43
Family Pentraxin (pentaxin) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UKU8
Sequence length 285
Comment (tr|G3UKU8|G3UKU8_LOXAF) Neuronal pentraxin 1 {ECO:0000313|Ensembl:ENSLAFP00000028457} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NPTX1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
QQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNSLEEGKGGLKNDTEERVKIESALTS
LHQRISELEKGQKENRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGV
GTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWE
AYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLT
PGEVYNLATCSTKALSGNVIAWAESHIEIFGGATKWTFEACRQIN
Download sequence
Identical sequences G3UKU8
ENSLAFP00000028457 ENSLAFP00000028457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]