SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UMH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UMH6
Domain Number 1 Region: 283-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-57
Family SPRY domain 0.0000271
Further Details:      
 
Domain Number 2 Region: 5-74
Classification Level Classification E-value
Superfamily RING/U-box 9.9e-20
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000946
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UMH6
Sequence length 464
Comment (tr|G3UMH6|G3UMH6_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000029035} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LOC100670023 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
ALAGVRAEANCPICLDYFRDPVTIKCGHNFCRSCIQQSWEDQQDWFRCPVCCHPCLQLHL
RSNTQLGNIAEIAKLLHITRSKRKREEETRLCKKHNQELTHFCEEDLEILCSLCTQPPNH
QDHLVRSIEEAASHHRKRLMSYMEPLKKQVADIQKLVTSQDREPSELRKKVEKQRKELFS
EFEHLNKFLDREHEAALSRLAYEEKHVQQKLNANITAFSESISTLNSLLKEVAEKSVMSE
VKLLTDIQSIQNRCESLNPPVLYSFQLTKEGCSLPPQYSALQKVIQKFKEDVTLDPERAH
RNLFVSADKKSVTFVKKTQRLPPNPKRFKFDPVVLGCEEFSSGRHYWEVEVGEKPEWSVG
LCKDSLSRKAKRPPAGQERCWAIHLCNGNYVAQGTFPVTLVVTEKPRGIGIYLDYELGEI
SFYSLNDRSHIHSFTDRFSEILKPYFCIGRDSQPLTICAVRDYE
Download sequence
Identical sequences G3UMH6
ENSLAFP00000029035 ENSLAFP00000029035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]