SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UNI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UNI0
Domain Number 1 Region: 404-668
Classification Level Classification E-value
Superfamily NHL repeat 3.92e-50
Family NHL repeat 0.0000531
Further Details:      
 
Domain Number 2 Region: 287-381
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 70-132
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000147
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UNI0
Sequence length 668
Comment (tr|G3UNI0|G3UNI0_LOXAF) Tripartite motif containing 71 {ECO:0000313|Ensembl:ENSLAFP00000029389} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TRIM71 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
XSSCDEGNASSRCLDCQELCDNCVRAHQRVRLTKDHYIERGPPGPAAAAAAAQQLGLGPP
FPSSPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRECTMGRHGGHSFTYLQEALQ
DSRALTIQLLADAQQGRQAIQLSIEQAQAVAEQVEMKAKLVHSEVKAVTARHKKALEERE
CELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQVLEEGRALDILLARDRMLA
QVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSSGAFAPLTKATGDGLKRALQ
GKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVNDQQNGTYVVSYRPQLEGE
HLVSVTLCNQHIENSPFKVVVKSRSYVGIGLPGLSFGSEGDSDGKLCRPWGVSVDKEGYI
IVADRSNTRIQVFKPCGTFHHKFGALGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIF
TFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGRILVSDTRNHRIQLFGPDGVFLNKYGFE
GALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGV
AVDQEGRIIVADSRNHRVQMFESNGSFLCKFGSQGSGFGQMDRPSGIAVTPDGMIVVVDF
GNNRILIF
Download sequence
Identical sequences G3UNI0
ENSLAFP00000029389 ENSLAFP00000029389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]