SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UNJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UNJ5
Domain Number 1 Region: 202-381
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-26
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 2 Region: 29-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.67e-23
Family Laminin G-like module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UNJ5
Sequence length 2322
Comment (tr|G3UNJ5|G3UNJ5_LOXAF) Chondroitin sulfate proteoglycan 4 {ECO:0000313|Ensembl:ENSLAFP00000029404} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CSPG4 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
SIIGLGHPSQQRLLPLGQGLSLDQRPLSHIASFFGENHLEVPVAMALTDIDLQLQFSTSQ
PEALLLLAAGPADHLLLQLYSGRLQVRLVLGQEEMRLQTPAETLLSDSVSHTVVLTVTDS
WATLSVDGLLNTSAPAPGAPLEVPYGVFVGGTGSLGLPYLKGTSHPLRGCLHTATLNGRS
LLRPLTPDVHEGCAEEFSAGDDVALGFSGPHSLAAFPAWGTRDEGTLEFTLTTRSRQAPL
AFQAGGRRGDFIYVDVFEGHLRAMVEKGQGTVLLHNSMPVADGQPHEVSIHIDVHRLEIS
VDQYPTRTSNRGVLSYLEPHGNLLLGGLDVEASRHLQEHRLGLGPGAANVSLLGCMEDLS
VNGQRQGLRDALVTRNMAAGCRPEEEEYEEDAYGPYEAFSTLAPEPWLSMELPEPCLPEP
GLPPIFANFTQLLTISPLVVAEGGTAWLEWRHVQPTIDLSDAELRKSQVLLSVSRGARHG
ELELDIPGAQGRKMFTLLDVVNRKARFVHDGSEDTSDQLVLEVSVTARGLVPSCLRRGQT
YILPIQVNPVNDPPRVIFPHGSLMVILEHTQKALGPEVFQAYDPDSACEGLTFQLLGNPA
GLPVERRDQPRQPAVEFSCRELEAGSLVYIHRGGPAQDLTFRVSDGLQASTPATLKVVAV
RPAIQIRHNTGLRLAQGSTAPIMPANLSVETNAVGQDVSVLFRVMGALKFGELQKQGAGG
VEGAEWRAAQAFHQHDVDQGRVRYLSTDPKHHTEDTMENLALEVQVGQETLSNFSFPITI
QRATVWLLRLEPLHTQNTQQEPLTTAHIEATLEGADPSPISFHYEVVQAPRKGNLRLQGT
RLSDGQGFTQDDLQAGRVTYGATTRASEAVEDNFRFRVTAPSHFSPLYTFPIHIRGDPDA
PVLTNVLLSVPEGGEGVISADHLFVKSLNSASYLYEVMERPRHGRLAWRETQDKSTMVMS
FTNEDLLHSRLVYQHDNSETTEDDIPFVATRGEGSGGMAWEEVRGVFRVAIQPVNDHAPV
QTISRVFHVARGGQRLLTTDDVAFSDSDSGFADGQLVLTRKDLLFGSIVAVDEPTRPIYR
FTQEDLRNRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVANGSILVVPQG
GQSTIDTAVLHLDTNLDIRSGDEVHYFVTSVPRWGQLLRAGQPAMAFSQQDLLDGAILYS
HNGSLSPRDTLAFSVEAGPVHTDATLQVTIALEEPLPPLRLVQHKKIYVFQGEAAEIRRD
QLEAAQEAVSPADIVFSVKTPPSAGYLVMLSHGTFADQPPSLDPVQSFSQEAVDAGQVLY
LHSRPEAWTDAFSLDVASGLGAPLEDIRMELEVLPAVIPLEAQNFSVPEGGIRTLAPPLL
RITGPYFPKLLGLDLQVLEPPQHGALQREEGPQDRTLQSFSWREVEQRLIHYVHDGSETL
TDTFVLVANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQIWEGATAPITSEALKGT
DRDSEPEDLVYTIEQPSNGRVVLRTAPDTEVHSFTQAQLDGGLVLFTQRGALDGGFHFDL
SDGEHTSSGHFFYVVARKQLLLSLEGSQMLTVCPGSVQPLSSHNLKASSSGGTDPHHLLY
RVVQGPQLGRLFHAQQGSTGEALVNFTQAEVSSGNVLYEHEMPPAPFWEARDTVELLLSS
PPAPDLAATLSVTVSFEAACPQRPSRLWRNKGLWVPEGQRAEITVTALDASNLLASIPSP
QRPEHDVLFQVTQFPTRGQLLVSEEPLHAGRPHFLQSELAVGQLVYSHGGGGLQQDGFRF
RAHLQGPAGASVVGPQTSEAFVITVRDVNERPPQPQASVPLRLTRGSQAPVSRAQLSVVD
PDSAPGEIEYKVQRAPHNGFLSLAGGSPGPVTHFTQADVDAGRLAFMANGSSVAGTFQLS
VSDGASPPLPMSLAVDVLPSTIEVQLQAPLEVPQALGRASLSRQQLQVVSDREEPDAAYR
LTQGPKYGHLLVGGKPASAFTQLQIDQGQVVFAFTNFSSAHDFFSVLALARGANASATVN
VTVRALLHVWAGGPWPQGATLRLDPAVLDAGELANLTGSVPRFRLLAGPQHSRVVRVPRA
RTEPRDGQLVEQFTQQDLEDGRLGLEVGRPEGRPPGPAGDSLTLELWAQGVPPAVASLDF
ATEPYNAARPYRVALLSLPEAARTEAGKPESGTPTSEPGPAASSPTSTVARGGFLGFLEA
NMFSVIIPVCLVLLLLALILPLLFYLRKRNKTGKHNVQILTAKPRNGLTSDTETFRKVEP
GQAIPLTAVPGQSPPLGSQPDPELLQFCRTPNPALKNGQYWV
Download sequence
Identical sequences G3UNJ5
ENSLAFP00000029404 ENSLAFP00000008979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]