SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UNX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UNX2
Domain Number 1 Region: 658-969
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-91
Family Protein kinases, catalytic subunit 0.0000000476
Further Details:      
 
Domain Number 2 Region: 123-197
Classification Level Classification E-value
Superfamily HR1 repeat 1.23e-24
Family HR1 repeat 0.0000819
Further Details:      
 
Domain Number 3 Region: 18-97
Classification Level Classification E-value
Superfamily HR1 repeat 6.8e-20
Family HR1 repeat 0.00034
Further Details:      
 
Domain Number 4 Region: 378-476
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000347
Family PLC-like (P variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UNX2
Sequence length 988
Comment (tr|G3UNX2|G3UNX2_MELGA) Protein kinase N2 {ECO:0000313|Ensembl:ENSMGAP00000017253} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PKN2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
HRCFSFQGDAKSLLVSENLSTGQKLDFSDTMVQQKLDEIKDQIKREIRKELKIKEGAENL
RKVTTDKKNLAYVDNILKKSNKKLEDLHHKLQELNAHIVVTDPEDVTDCPRTPDTPNSDP
RFPTNNRLMALKKQLDIELKVKQGAENMIQMYSNGSSKDRKLLATAQQMLQDSKTKIEVI
RMQILQAVQTNELAFDNGDGLQKKFLTITSPLKKNITPFKSSFKIAQSLNFNSHECTKSC
GHPRLTRKHEQDKNMKQENSQKLIRDKCSYRMSQTLTELLSIFPPDALKVIYLTVTNSSL
NTINSFILNTKSQQSVCSFVCLVLGTLEVRLMGCQDILENVPGRSKATSVTLPGWSPNEV
RTTFMGRTTKAKAGISKNLLKTDDLSNEVCAVLKLDNTVVGQTSWKPISNQSWDQKFTLE
LDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNPVIE
RRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQASVSAAV
PVVDARIPELALPASDSPVAKLDFELEPEPPPAPPRASSLGEICEPSSEMKAPDMPAQAS
KVEDDVSTFDFENGRNSIVPKLQPGIICESDVPHSDTKYTNIREPEDRRTQQRFQFSLKD
FRCCAVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVR
HPFLVNLFACFQTKDHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEH
KIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTETSYTR
AVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNP
ERRLGAGEKDAEDVKKHHFFRLIDWNALLAKKVKPPFVPTIRGREDVSNFDDEFTSEAPI
LTPPREPRILSEEEQEMFRDFDYIADWC
Download sequence
Identical sequences G3UNX2
ENSMGAP00000017253 ENSMGAP00000017253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]