SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UP83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UP83
Domain Number 1 Region: 1244-1415
Classification Level Classification E-value
Superfamily C-type lectin-like 6.91e-72
Family Endostatin 0.00000024
Further Details:      
 
Domain Number 2 Region: 127-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-33
Family Laminin G-like module 0.0077
Further Details:      
 
Domain Number 3 Region: 2-115
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-25
Family Frizzled cysteine-rich domain 0.00051
Further Details:      
 
Domain Number 4 Region: 852-985
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000273
Family Endostatin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UP83
Sequence length 1420
Comment (tr|G3UP83|G3UP83_MELGA) Collagen type XVIII alpha 1 chain {ECO:0000313|Ensembl:ENSMGAP00000017375} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=COL18A1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
GHCLPLPAHLPFCSVLGTNHVRLPNYLSHSSEVEIRAALHEWEGLLESRCHRYLEWFLCL
LLVPGCSASVPVTPPPCQGFCEAVRDLCWMHSAGGRLPLPCDSLPKEDEGYSCVFVNVSS
ENLSSEVSLLELIGDPPPEGIVKIYGHENRPGYVFGPSANTGQVARYHLPSPFYRDFSLL
FHIQPTTPRAGVLFAITDSTQSIIYVGVKLSDLQMGKQQIIFYYTEPGSQSSYAAATFTV
PTLLNQWANFAISVEEDEVILYLDCEEHERVRFERSPDEMELEEGAGLFVGQAGGADPDK
YQGVIADLRLRGDPRAAEYHCEEEDDTEASGDFGSGAEDRHRPLGKDKAQGIPGLLDAVP
VTSPPVVEGSGTRSSVGSPQQAERTRVEERLQVSTGGTGPKGEKGEKGERGLKGDSGTIG
ILGPGTAKGEKPGSKGQKGEPGEPGPPGPLSRHTDGMSLEQVTGPPGPTGPPGKDGAPGR
DGEPGDPGEDGKPGEMGPPGFPGTPGESGQKGEKGDPGVGPRGPPGPPGPPGPPGPSSKQ
DRLTFIDMEGSGFGGDLETLRGPRGPPGPPGPXPGEPGRFGMNSTDLPGQPGLSGRDGTP
GPPGPEGPLGPPGKDGMPGLPGPKGERGDVGDLGLPGAPGPKGSKGEAGPAGPPGETGLA
GLPGPVGPRGQPGPPGPPGPPGPGYEAGFGDMEGSGLPLATGSPGPRGPSGPQGVPGLPG
IKGEVGSLGQPGLPGPKGDAGVPGVDGRPGLEGFPGPQGPKGNRGSPGEKGERGQDGVGL
PGPPGPPGPPGQVIYISSEDRPLAALPGPEGRPGLAGFPGPVGPKGDPGSPGIQGAPGMK
GEKGEPGVIISPDGTIVAANMKGQKGEPGLQGPMGPSGPHGRAGMKGEIGFPGRPGRPGM
NGLKGEKGDPVDISGMLSLRGPPGPPGPPGPPGPPSSVVYDSNNGFSDASRPAFPGKPGD
PNQGFTGQKGEKGDVGAPGPPGQFLYDLSRFSANLRGDKGEAGPKGEKGEPGGSTLYGPG
VTGPPGPQGYPGPPGPKGDSIVGPPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPH
RQAISIPGPPGPPGPPGPPGTSGTSLGLRAMPTYQAMLSAAHELPEGGLIFVTDRQELYV
RLRGGFRRVLLEEHTLIPSSALDNEVYDKLPSIHYGGAQQPVHPLRNHSPPPTARPWRGD
EVVANQHRLPQPPLLQQHELLNSYYIHRWPDPASVAAHVHRDFQPALHLVALNTPLSGGM
RGIRGADFQCFQQARQVGLAGTFRAFLSSRLQDLYSIVRRADRTSVPIVNLRDEVLFSNW
EALFTGSEAPLRAGARILSFDGRDILQDSAWPRKSIWHGSDVKGRRLPESYCEAWRTDER
GTSGQASSLSSGKLLEQSASSCQHAFVVLCIENSFMTAAK
Download sequence
Identical sequences G3UP83
ENSMGAP00000017375 ENSMGAP00000017375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]