SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UPK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UPK3
Domain Number 1 Region: 930-1098
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-44
Family C-type lectin domain 0.00000808
Further Details:      
 
Domain Number 2 Region: 73-189
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-39
Family Link domain 0.0026
Further Details:      
 
Domain Number 3 Region: 184-284
Classification Level Classification E-value
Superfamily C-type lectin-like 6.92e-28
Family Link domain 0.0061
Further Details:      
 
Domain Number 4 Region: 1099-1159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 895-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UPK3
Sequence length 1208
Comment (tr|G3UPK3|G3UPK3_MELGA) Neurocan {ECO:0000313|Ensembl:ENSMGAP00000017500} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=NCAN OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
XKVRSASGQREDVPILVAKDNVVKVVKAYEGRVSLPGYARDRYNGTLLLRAARASDAGLY
RCEVVAGIDDEQDLLPLEVMGVVFHYRPAGARYALTFAAARRACMDNSAIIASPQHLQAA
FEDGYDNCDAGWLADQSVRYPITLSRPGCYGDRNSLPGVRSYGQREPGELYDVYCYAQEL
QGKVFYATAPGRFTLLGAQRHCRGRGAALATTGQLYLAWREGLDQCDPGWLADGSVRYPI
LAPRRKCGGEAPGVRTLYRFPNRTGFPPPTSKFDAYCYKGDTADAPDSTAEQREQEPLGS
DNVLVEREDMATSGDSPRAGVLRQLGAAGPGGAEDEQLQLASSVTAAWRGDIPGGSTTAS
SSSPSSSVWPLEDEALNAVDQAPQGSRQQLFGSSPAAAPREFPDPPDPLFTLHPQTQSPA
QEITSSPPALGTVPIVAAETPSTPKQSSYAGLNGRYFQLQQQSRDPSVAQDPTVADDHTV
AGDPAGRVTQAPILALEVKGAAANAVETWSMTHPSAESPHRGSPYPLSNEVEEEIGHKLL
APSTIPVPPSQRGLPQWSPSTAPHGRGDPTLTSLPSSPPTPVAPSDTSHHQDVSTGEAQP
RGDSAQPPADVTEDFSGDAAPKEDDSPIPPWPPLPPAPLVAEGPGTAAQPISDSGTLGDG
SLERQRKAVTFILLPMGLPGSPSPTAVSSPHPQSRLSPTDPQGALEMGAEPTREHLDVGT
GLQDEAAVTPVAPDVPSASPTDSEVTPRLGSEWPSEGSGRVGDGPTAAPQHPNPLSPGLE
GEEYPPHPQTPQQPPSPGEEDTSEEAKNEPPASTATHPPAPPDIHWPSPTAPHPWVPDGP
EAPSAGPLFEPTTPGGAGGALLLDADSGSGEEPVLEEQELLVWADSSNSSQHAPADPCQT
NPCLHGGTCHANGSVCGCSCAPGFTGENCEIDIDDCLSSPCQNGGTCIDEVNAFVCLCLP
SYGGSRCEKDTEGCDHNWHKFQGHCYRYFSRRRSWEDAERDCRRRAGHLTSIHSQEEHGF
INSFGHENTWIGLNDRIVEQDFQWTDNTGLQYENWRENQPDNFFAGGEDCVVLVSHEIGK
WNDVPCNYNLPYICKKGTVLCGPPPEVENAFLVGKKKEKYSIHSSVRYQCEEGFTQRHVP
TIRCHSNGKWDRPKLLCTKPRRSHRARRHHRHRHSHPHHQHHHHKPRKERRKHRKHLRLD
WMEEGHYF
Download sequence
Identical sequences G3UPK3
ENSMGAP00000017500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]