SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UQS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UQS0
Domain Number 1 Region: 67-164
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-21
Family DBL homology domain (DH-domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UQS0
Sequence length 167
Comment (tr|G3UQS0|G3UQS0_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000018011} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
SLTGSPHLSELSINSQGGPSVANMSLSPNLSPDAKQSSPLISPLLNDPSCIRTEEEEEVK
KKRFPTEKAYFIAKEVATTERTYLKDLEVITSWFQSAVSKEDCMPETLKNLIFSNFEPLH
KFHTGFLKEIEQRLALWEGRSNAHIKGGHQRIGDVMLKNIQSMKVGM
Download sequence
Identical sequences G3UQS0
ENSMGAP00000018011 ENSMGAP00000018011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]