SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UQW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UQW6
Domain Number 1 Region: 32-238,412-498
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.54e-62
Family Bacterial dinuclear zinc exopeptidases 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UQW6
Sequence length 502
Comment (tr|G3UQW6|G3UQW6_MELGA) Carnosine dipeptidase 2 {ECO:0000313|Ensembl:ENSMGAP00000018062} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CNDP2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
HFRSRIFYLFLWLFLCVLRFLSHCSHKMAALDTLFKYIDEHQDLYVKRLAEWVAIQSVSA
WPEKRAEIRRMMEVAAKDIERLGGTAQLMDIGTQKLPDGSEIPLPPIILGKLGSDPHKKT
VCVYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVLAWLNALEAYQKTNQE
FPVNIKFCLEGMEESGSEGLDELIFAQRNAFFKDVDYICISDNYWLGKNKPCITYGLRGI
CYYFIEVECSDKDLHSGVYGGSIHEAMTDLIALMGSLIDKKGKILIPGINEAVASVTGEE
LAIYEKIDFDLEEYAKDVGATKLLHDTKRDILMHRWRYPSLSLHGIEGAFSASGAKTVIP
RKVIGKFSIRLVPNMTPEEVTKHVKDYLSKQFAELQSPNKFKVYLGHGGKPWVSDFDHPH
YMAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGAADDGAHSQNEKLNR
YNYIQGVKMLGAYLYEVSQTSM
Download sequence
Identical sequences G3UQW6
ENSMGAP00000018062 ENSMGAP00000018062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]