SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3URL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3URL1
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.02e-70
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1284-1396
Classification Level Classification E-value
Superfamily E set domains 2.2e-36
Family Filamin repeat (rod domain) 0.00000507
Further Details:      
 
Domain Number 3 Region: 1195-1307
Classification Level Classification E-value
Superfamily E set domains 5.87e-34
Family Filamin repeat (rod domain) 0.00000446
Further Details:      
 
Domain Number 4 Region: 1567-1682
Classification Level Classification E-value
Superfamily E set domains 3.34e-32
Family Filamin repeat (rod domain) 0.00000566
Further Details:      
 
Domain Number 5 Region: 1474-1586
Classification Level Classification E-value
Superfamily E set domains 5.67e-32
Family Filamin repeat (rod domain) 0.0000199
Further Details:      
 
Domain Number 6 Region: 803-923
Classification Level Classification E-value
Superfamily E set domains 1.53e-28
Family Filamin repeat (rod domain) 0.00042
Further Details:      
 
Domain Number 7 Region: 1768-1862
Classification Level Classification E-value
Superfamily E set domains 5.47e-28
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 8 Region: 623-732
Classification Level Classification E-value
Superfamily E set domains 2.51e-27
Family Filamin repeat (rod domain) 0.00067
Further Details:      
 
Domain Number 9 Region: 242-355
Classification Level Classification E-value
Superfamily E set domains 3.2e-27
Family Filamin repeat (rod domain) 0.00091
Further Details:      
 
Domain Number 10 Region: 1110-1218
Classification Level Classification E-value
Superfamily E set domains 8.01e-27
Family Filamin repeat (rod domain) 0.0000168
Further Details:      
 
Domain Number 11 Region: 2142-2235
Classification Level Classification E-value
Superfamily E set domains 1e-26
Family Filamin repeat (rod domain) 0.0000089
Further Details:      
 
Domain Number 12 Region: 514-619
Classification Level Classification E-value
Superfamily E set domains 1.34e-26
Family Filamin repeat (rod domain) 0.00014
Further Details:      
 
Domain Number 13 Region: 1951-2043
Classification Level Classification E-value
Superfamily E set domains 2.54e-25
Family Filamin repeat (rod domain) 0.0000046
Further Details:      
 
Domain Number 14 Region: 721-822
Classification Level Classification E-value
Superfamily E set domains 7.08e-24
Family Filamin repeat (rod domain) 0.00052
Further Details:      
 
Domain Number 15 Region: 331-438
Classification Level Classification E-value
Superfamily E set domains 8.28e-24
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 16 Region: 1017-1106
Classification Level Classification E-value
Superfamily E set domains 2.94e-23
Family Filamin repeat (rod domain) 0.00000986
Further Details:      
 
Domain Number 17 Region: 1850-1947
Classification Level Classification E-value
Superfamily E set domains 1.47e-22
Family Filamin repeat (rod domain) 0.00000428
Further Details:      
 
Domain Number 18 Region: 902-1014
Classification Level Classification E-value
Superfamily E set domains 6.07e-22
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 19 Region: 2061-2156
Classification Level Classification E-value
Superfamily E set domains 7.34e-22
Family Filamin repeat (rod domain) 0.0000397
Further Details:      
 
Domain Number 20 Region: 2324-2406
Classification Level Classification E-value
Superfamily E set domains 2.67e-20
Family Filamin repeat (rod domain) 0.0000611
Further Details:      
 
Domain Number 21 Region: 1398-1490
Classification Level Classification E-value
Superfamily E set domains 2.67e-18
Family Filamin repeat (rod domain) 0.0000322
Further Details:      
 
Domain Number 22 Region: 2240-2315
Classification Level Classification E-value
Superfamily E set domains 6.67e-16
Family Filamin repeat (rod domain) 0.000037
Further Details:      
 
Domain Number 23 Region: 1706-1782
Classification Level Classification E-value
Superfamily E set domains 7.34e-16
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 24 Region: 2457-2517
Classification Level Classification E-value
Superfamily E set domains 0.0000000018
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3URL1
Sequence length 2517
Comment (tr|G3URL1|G3URL1_MELGA) Filamin B {ECO:0000313|Ensembl:ENSMGAP00000018320} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FLNB OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
DAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQHDLSDGLRLIALLEVLSQKRMYRKYHQRP
TFRQMQLENVSVALEWSVRASSWSPSVNSKAIVDGNLKLILGLIWTLILHYSISMPVWED
EGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWETWD
PSKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKP
KLNPKKARAYGRGIEPHGNMVKQPAIFTVDTISAGQGDLMVFVEDPEGNREEAKIMPSSD
KNKTYSVQYMPKVTGPHKVSVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLEATGNI
ANKPTYFDLYTAGAGVGDVIVEVEDPQGRCLAEVAVEDKGNQVYRCVYKPVQAGPHVVKV
TFAGEAIPKTPCNVLIGEGMLFQNCSPGQNMWLLSVVLLSGTTASRANQIFDTGSMTSLL
EGLLGAMPPQDSISSLKCLGRKACKLYVSNCASFSCSPFEVHIGHEAGPQKVRAWGPGLH
EGIVGKSADFVVESIGTEVGSLGFAIEGPSQAKIECDDKNDGSCDVKYWPKEPGEYAVHI
MCDDEDIKDSPYMAFIRPASGDFNPDKVRAYGPGLERSGCIVNNLAEFTVETKDAGKAPL
KIYAQDGEGNPIDIQMKSKPDGVFACSYVPVKPIKHTISIVWGGANVPNSPFRVLIGQGS
HPQKVKVFGPGVERTGLKASEPTHFTVDCTDAGEGDVSVGIKCDARVVSDEEEDIDFDII
HNANDTFTVKYAPPAAGRYTIKVLFAGEEIPASPFRVKVDPSHDASKVKAEGPGLSKTGV
ENGKPTHFTVFTKGAGKAPLDVQFSSPVSGEVVADVDIIDNYDYSHTVRYTPIQQGPVKV
LVTYGGDPIPKSPFTVGVAAPLDLSKVKVNGLENRVEVGKDQEFVIDTRGAGGQGKLDVN
ISSPMRKAVPCLVEPVLGKECSTAKYIPREEGLYVVDVSYDGNPIPGSPYTVEATLPPDP
SKVKAHGPGSRRPRWKTSSIYIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLP
TKPGEYFVNILFEEVHIPGSPFKADIEMPFDVSKVIATGPGLERGKVGEAGLLNVDCTEA
GPGNLRVDIVSDTGSKAEIQIDDNKDGTYVVTYVPLSAGMYTIKMKYGGEQVPKFPARVK
VEPAVDTSRVKVFGPGVEGKDVFREATTEFTVDARPLTKAGGDHIRTQITSPSGSPTDCQ
IQDNADGTYAVEYTPFEKGPHTVSVTYDGVPVPNSPFRVNVTEGCHPSRVKAQGPGLKEA
FTNQPNAFSVVTRGAGIGGLGITVEGPSESKISCKDNKDGSCSAEYVPYVPGDYDVNITY
GGEHIPGSPFKVPVKDVVDPSKVKIAGPGLGTAVRAKIPQSFTVDTSKAGAAPLEVVVAG
PRGIVEPVNVVDNGDGTHTCTPLHRRDHDLCQIDEEIPRSPFKVKVLPTYDASKVTASGP
GLSSYGIPASLPVEFAVDAKDAGQGLLTVQITDQEGKPKRVDIHDNKDGTYTVTYVPDKT
GRYTIGVKYGGDDIPSSPYRIRASPAGDASKCLATGPGIAPTVRTGEEVGFVVDAKSAGK
GKVTCTVLTPDGTEAEADVVENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVT
EEAYVPVGDMNGMGFRPFDMVIPFAVRKGEITGEVHMPSGKTDTPDIVDNKDGTVTVRYA
PTEVGLHEMHIKYMGNHIPESPLQFYVNYPNSGSVSAYGPGLIYGVANKPATFTIVTEDA
EEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGNYSILVKYNDKHIPGSPFTAKIT
DDNRRRSQVKLGSAAEFLLDINETDLSLLTASIKAPSGRDEPCLLKRLPNNHIGISFIPR
EVGEHLVSIKKNGNHVPNSPVTIMVVQSEIGDARRARVYGRGLVEGRTFEMCDFIVDTRD
AGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHIPGNPFTVKI
SGEGRVKESITRTRRAPSVATVGSICDLNLKIPEIDCGDMTAQVTSPSGRNSDAEIVEVD
KNTYCVRFVPQEMGVHTVDVKYRGQPVPGSPFQFTVGPLGEGGAHKVRAGGPGLERGETG
VPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDHKDGSCGVSYIVQEPGNYEVSIKFNDE
HIPESPYLVPIIAPSDDARRLTVTSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGA
VEECHVSELEPDKYAVRFIPHENGIHSIDVKFNGTWWAAPSRCVLVGQAGNPTLVTAYGP
GLESGTTGLQSEFFINTTKAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLI
GVKYGGPNHIVGLQGKGYSARLVTLGSANETSSIMVESVTRSSTETCYSAIPKSTSDASK
VVSRGAGLSKAFVGQKSSFSVDCSKAGSNMLLVGVHGPTIPCEEVSIKHLGNHQYNV
Download sequence
Identical sequences G3URL1
ENSMGAP00000018320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]