SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3USE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3USE2
Domain Number 1 Region: 42-192
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.75e-30
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 214-291
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.12e-27
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3USE2
Sequence length 700
Comment (tr|G3USE2|G3USE2_MELGA) Growth arrest specific 2 like 3 {ECO:0000313|Ensembl:ENSMGAP00000018615} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=GAS2L3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MQNAVQVWFGDDLPLSPRSPLTPRHGPGLADVCLYDQWISVRHEATLVPMQEDLSIWLSG
LLGIEVTAEQLLEELDNGVLLCQLIGVLQNTIKKSCSSNNLRNFPMRKVPCKKDAPSGSF
FARDNTANFLNWCRAIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVLV
KLEKEIELEETLLRTSGPASPVDTAKSCCHHGDLHEAVKHIAEDPPCSCSHRFSIEYLSE
GRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRVLQFATLEQKILAFQKGV
TSDNISIMNPMSAVNMFQKQPANPPTPVPALKEKLSMGRQTSTKVPVHTSSAAKLLSARP
KLADTQSPFKPLMGTSKKLASPAHHSPAPVPSLPASKSSSSTRSRAALVHSETLRERIRS
PDAPKVRFAPAQGSPATGMHSALSASKRQLSQLPATGEALASKQKCVPSKSKPVSVTKTK
VNSVAPRPARPPASNLRAVAKFAHSQQLYVKSPSENTTQGSGTGSQHPQKAPQTASHLAR
NLKTASILKHSASVPSLAVSKSLKSPPMPGSASKNLIASVNKTPTTEHLQTQNVNKPPEV
GPSSSKPPERTPLSVVRLPQTSAKVAVTKKAVQPSTKSQPSSRDLQANGNLVPAAKKPLS
KGKSATACNKGAPTAPKGSLLKSKQDDHYFVMTGSKKPRK
Download sequence
Identical sequences G3USE2
ENSMGAP00000018615 ENSMGAP00000018615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]