SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3USI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3USI2
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily E set domains 1.91e-38
Family ML domain 0.00000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3USI2
Sequence length 122
Comment (tr|G3USI2|G3USI2_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000018657} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=NPC2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
GSKDGSIQEVNVSPCPRQPCQLVKGTSYSINVTFASKIESQGSKAKVYGEMLHVDIPFPI
PEPDGCKSGIQCPIQKGHSYSYLNKLPVKSEYPSIKLIVKWELVDDQDQMLFCWKIPVQI
TS
Download sequence
Identical sequences G3USI2
ENSMGAP00000018657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]