SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3UTU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UTU7
Domain Number 1 Region: 14-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-85
Family Calponin-homology domain, CH-domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-31
Family Spectrin repeat 0.00000084
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-24
Family Spectrin repeat 0.00000107
Further Details:      
 
Domain Number 5 Region: 628-739
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-22
Family Spectrin repeat 0.00000089
Further Details:      
 
Domain Number 6 Region: 738-863
Classification Level Classification E-value
Superfamily EF-hand 8.16e-19
Family EF-hand modules in multidomain proteins 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UTU7
Sequence length 891
Comment (tr|G3UTU7|G3UTU7_MELGA) Actinin alpha 2 {ECO:0000313|Ensembl:ENSMGAP00000019182} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ACTN2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MQYTYNYEEDEYMTQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
NGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHLSWKDGLGLC
ALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDVVNTARPDERTIMT
YVSCYYHAFAGAQKAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENR
TPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKM
VSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHEQWAYGKEQILLQK
DYESASLTEVRAMLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNDRCQKIC
DQWDSLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHS
IEEIQSLISAHDQFKATLPEADGERQAILSIQNEVEKVIQSYSMRISASNPYSTVTVEEI
RTKWEKVKQLVPQRDQSLQEELARQHANERLRRQFAAQANVIGPWIQTKMEEIARSSIEM
TGPLEDQMNQLKQYEQNIINYKHNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELL
LTTIARTINEVETQILTRDAKGITQEQMNDFRASFNHFDRDESDNLHSDEFKACLISLGQ
VGNDLQGEAEFARIMSLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKP
YILADELRRELPPEQAQYCIKRMPQYTGPGSVPGALDYTSFSSALYGESDL
Download sequence
Identical sequences A0A1D5PNV5 G3UTU7
ENSMGAP00000019182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]