SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UU99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UU99
Domain Number 1 Region: 289-610
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.24e-89
Family p120GAP domain-like 0.0000892
Further Details:      
 
Domain Number 2 Region: 569-706
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-46
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 137-299
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-26
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 
Domain Number 4 Region: 11-124
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000748
Family Synaptotagmin-like (S variant) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UU99
Sequence length 827
Comment (tr|G3UU99|G3UU99_MELGA) RAS p21 protein activator 3 {ECO:0000313|Ensembl:ENSMGAP00000019357} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=RASA3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
VFFFSFLSSGEAKNLPTYPGPNKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEI
PRTFRHLSFYXXXXXXXXXXXXTGKVAIQKEDLQKYHNRDTWFQLQHVDADSEVQGKVHL
ELRLSEVITDTGVVCHKLATRVLECQGLPIVNGQCDPYATVTLAGPSRSEAKKTKVKKKT
NNPHFDEVFYFEVTRPSSYNKKSQFDIEDVDEVDKMEIRVDLWNASNLKFGDEFLGELRL
PLKFLRQSSSYEAWYFLQPRDNGNKSLKPDDLGSLRLNVVYTEDHVFSSDYYSPLRDLLL
KSADVEPVSASAAHILGEVCREKQEAAIPLVRLFLHYGRIMPFISAIASAEVKRTQDPNT
IFRGNSLTSKCIDETMKLAGMHYLQVTLKPIIDEICQVHKPCEIDPVKLKDGENLENNRE
NLRQYVDRIFTVITKSGVSCPTVMCDIFFSLRESAAKRFQGDPDVRYTAVSSFIFLRFFA
PAILSPNLFQLTPHHPDPQTSRTLTLISKTIQTLGSLSKSKSANFKESYMATFYDYFNEQ
KYADAVKNFLDLISSSGRRDHKSIEQPILLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNH
EFTYQKSKGDHPLCSIPIENILAVERLEEESFKMKNMFQVIQPERRVLYIQANNCVEAKD
WIDILTKVSQCNKKRLTVYHPSAYLNGHWLCCKATADNTPGCTPCTGGLPANIQLDIDGD
RETERIYSLFNLYMPKLEKMQEACGSKSVYDGPEEEEYSTFIIDDPKETYKTLKLIIEGV
GTLEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQTYIRQQSEISAHSI
Download sequence
Identical sequences G3UU99
ENSMGAP00000019357 ENSMGAP00000019357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]