SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UUU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UUU1
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-48
Family DBL homology domain (DH-domain) 0.0000434
Further Details:      
 
Domain Number 2 Region: 154-284
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-35
Family Pleckstrin-homology domain (PH domain) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UUU1
Sequence length 285
Comment (tr|G3UUU1|G3UUU1_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000019560} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LQMLFSNIEDILAVHKNFLSLVEECLQPEPSAHHEVGTCFLHYKEKFRIYDEYCSNHEKA
QKVLLDLNKIRTVRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLLKELLKRTPR
KHSDYAALMEALQAMKAVCSNINEAKRQMEKLEFLEEWQSHVEGWEGSNITDTCTEMLRS
GLLLKISAGNIQERIFFLFDNLLVYCKKKHSNQWKFVHKGRINTEVMEVENVDDGTXTDY
HSSGHTVINGWKIHNTAKNKWFVCMAKTPEEKQEWLEAILKERER
Download sequence
Identical sequences G3UUU1
ENSMGAP00000019560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]