SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UV91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UV91
Domain Number 1 Region: 242-478
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-57
Family DBL homology domain (DH-domain) 0.0000259
Further Details:      
 
Domain Number 2 Region: 476-604
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-37
Family Pleckstrin-homology domain (PH domain) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UV91
Sequence length 1066
Comment (tr|G3UV91|G3UV91_MELGA) Rho guanine nucleotide exchange factor 28 {ECO:0000313|Ensembl:ENSMGAP00000019765} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ARHGEF28 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
ERAYSLPEHSREKRIQEEEWDKYIVPSKTESEKYKVSRTFSFLMNRMTSTRNKYKKDRSL
FITKAQSMSLHGFHKKIQTLILVCLWCGQSVCWPKCQCKQCHYDVSENELQKMFTDPPQR
KYMSKYGKLSLQVLRGISSASDPEAPSGSVLPQILQTSVCEYGVNKLSLFYEVMGMTTQT
FRKIVALLISDTDKQDFMKKFSYLITYLKGAFYSVKLLMTYFEVDSSQWTDISSDAQEFE
AESWSLVVDPMFCNKQEKDVAKRQDVIFELMQTEVHHIHTLFIMSEIFRKGMKEELQLDH
STVDRIFPCLDELLEIHRQFFCRMRERRQESCEEGNERNFVISRIGDILVQQFSEENATK
MKKIYGEFCSHQKEAVNLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKY
PVLVERILQYTKEGSEEHKDLCRALRLIKDIIAAVDLKVNEYEKRQKLMEILNRTENKTY
TKLKSGHIFRKQDLMGKERILLHEGLVYWKTATGRFKDTLALLLTDMLLFLQEKDQKYIF
AAVDQKPSVISLQKLIVREVANEERGMFLISASSAGPEMYEVHTNSREERNSWMRHIQDA
VESCPEEQEEGKMGEYDEDRRIAEAKACKIQKCQESLSNQDQQICSCLEDKLHIYAELVD
MSGFEDVHVEPHLLIKPDYGETPQAASLLVAALKEVESLHVAVMSSQVNETDRLSEESTE
EPLPSDAVCAAVRLRDGSTGLRQIAWAESQKATVKASSSGVSIPIISSVSGGKGGSMSFP
GSTGTEIVQAIQNLTRLLYSIQAALAIQDSHRELHRLLLQENEKTSRSHSSWIPLFLEPE
KYRNSEKQREELANINKLQQQFQQEQQRWLRECEQWQQEQEVRAGLLEQREQACSCQEEL
LEKSRQGLALQLQEFQQSLERLQEGQKVLEKKRDSIKVQKKLLWHWKHGLQSNLLLPTGS
REVCFSPLLDSLHDENAFYLNEAVVRVSLSGLNRSDSSLIYEDVVYGLGISNSDMARTCE
NQVDFRVDTSCQPALTNELWKSTGPYQQMSFSCKSNKDAFNNGINL
Download sequence
Identical sequences G3UV91
ENSMGAP00000019765 ENSMGAP00000019765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]