SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UXY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UXY9
Domain Number 1 Region: 149-323,376-569
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.76e-92
Family Phosphonoacetate hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 642-908
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.89e-36
Family DNA/RNA non-specific endonuclease 0.0085
Further Details:      
 
Domain Number 3 Region: 56-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000288
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 104-144
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000288
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UXY9
Sequence length 910
Comment (tr|G3UXY9|G3UXY9_MOUSE) Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 {ECO:0000313|Ensembl:ENSMUSP00000133877} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Enpp2 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MARQGCFGSYQVISLFTFAIGVNLCLGFTASRIKRAEWDEGPPTVLSDSPWTNTSGSCKG
RCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCS
EDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRPPLIIFSVDGFRASYMKK
GSKVMPNIEKLRSCGTHAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDAT
FHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFWSVSIPHERRILTILQWLSLPDNERP
SVYAFYSEQPDFSGHKYGPFGPEESSYGSPLTPAKRPKRKVAPKRRQERPVAPPKKRRRK
LHRMDHYTAETRQDKMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDR
TEFLSNYLTNVDDITLVPGTLGRIRPKIPNNLKYDPKAIIANLTCKKPDQHFKPYMKQHL
PKRLHYANNRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFV
GYGPTFKYRTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFRPTLPEEVS
RPNYPGIMYLQSDFDLGCTCDDKNKLEELNKRLHTKGSTEERHLLYGRPAVLYRTSYDIL
YHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKND
KQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNV
ISGPIFDYNYNGLRDIEDEIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSS
FILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYRKTSRSYSEILTLK
TYLHTYESEI
Download sequence
Identical sequences G3UXY9
NP_001272924.1.92730 ENSMUSP00000133877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]