SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3V8K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3V8K8
Domain Number 1 Region: 141-406
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.06e-38
Family Eukaryotic proteases 0.00046
Further Details:      
 
Domain Number 2 Region: 46-108
Classification Level Classification E-value
Superfamily GLA-domain 1.08e-24
Family GLA-domain 0.00041
Further Details:      
 
Domain Number 3 Region: 97-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000577
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3V8K8
Sequence length 406
Comment (tr|G3V8K8|G3V8K8_RAT) Protein Z, vitamin K-dependent plasma glycoprotein {ECO:0000313|Ensembl:ENSRNOP00000026666} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Proz OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MADCISLHRGFILSFVLTLALHQVELSVFLPASEANNILLRWRRASSYLLEEFLQGNLER
ECYEEICNLEEAREVFENDASTDEFWSQYSGGFPCISQPCLNNGTCKDHIRSFSCTCAPG
YEGKTCAMAKNECHLERTDGCQHFCHPGQSSYMCSCAKGYKLGEDHRSCSPSDKCACGAL
TSQHIRTQMTDDICRSWPSFPWQVRLTNSEGEDFCAGVLLQENFVLTTAKCSLLHSNLSV
KADDDQQIRIKSAHVHMRYDKETGENDVSLLELEKPLQCPIPALPVCVPERDFAEHVLIP
GTKGVLSGWMLNGIDLDRTLTMLSVTQTDGEECGQILNVTVTTRTSCEKGSEVMGPWVEG
SVVTRQHKGTWFLTGILSSPPPPGQSHMLLLTSVPRYSMWFNQIMK
Download sequence
Identical sequences G3V8K8
NP_001296362.1.100692 NP_001296362.1.4139 ENSRNOP00000026666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]