SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VAM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VAM3
Domain Number 1 Region: 109-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000231
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3VAM3
Sequence length 259
Comment (tr|G3VAM3|G3VAM3_SARHA) EGF like domain multiple 7 {ECO:0000313|Ensembl:ENSSHAP00000000227} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=EGFL7 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LFLLSRRICSTAATKETVPVTESYIQRVYQPYITLCEGQRACSTYRTVYKTAYRHTPRTI
SPPQYACCPGWRRSNGLPGCGTAICQPSCQNGGSCARPGRCRCSAGWQGDICQTDVDECS
QPGHGCPQDCINVPGSYHCQCQEGYELSSDGKLCQPRSGSPQVTSALCPTGQPQPEASDE
MKEEIQKLRNRVDVLEEKLQLMLAPFHSLAPQAPEDGLSADHISLLAHSFQQLDRIDSLS
EQILFLEERLETCSCKNKQ
Download sequence
Identical sequences G3VAM3
ENSSHAP00000000227 ENSSHAP00000000227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]