SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VAT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VAT1
Domain Number 1 Region: 449-579
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 385-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000128
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 3 Region: 636-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000712
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 737-865
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 5 Region: 671-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000672
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 6 Region: 350-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 307-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 860-925
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000282
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VAT1
Sequence length 1245
Comment (tr|G3VAT1|G3VAT1_SARHA) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=JAG2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MLEQSRRMAATRLGLLFLTIWVQAAQSMGYFELQLSSVKNVNGELQNGNCCDSNRTAWPT
GSGWTCGRDECDTYVRVCLKEYQTKVTPTGPCSYGHGATPVLGGNTFSLNGGSNTGRSGH
QDRGSRDRGRVIIPFQYAWPRSFTLIVEAWDWDNGTQNDGLLIERVSHAGMINPEDRWKS
LHFSGHVAHLEVKIRVQCDENYYSSTCNKFCRPRDDFVGHYTCDQYGNKACMEGWMGPEC
KQAVCKQGCNLLHGGCTVPGECRCHYGWQGRFCDECVTYPGCLHGSCTEPWKCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCMNTEPDQYQCACPDGYSGKNCEIVEHACVSNPCANGG
SCHEVFSSFECHCPSGWSGPTCAIDIDECASNPCARGGTCIDQVNGFECICPQQWVGTTC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGVNCHININDCQGQCQNGGTCKDEVN
GYQCLCPRGFIGKHCELEKNECASNPCQNRGLCEDLVDGFRCHCTKGFSGVFCEVDIDFC
EPYPCQNGARCYSLEGDYYCACPEDYDGKNCSYPKDHCRNGSCKVINSCEIEVFTNTTRF
ISSKVCGPHGHCISQPGGNFTCTCESGFTGTYCHENINDCLGMPCQNGGTCIDEVDSFQC
FCPSGWEGELCDTNLNDCFPDPCHNGGHCIDLLNDFYCECRDGWKGKTCHSREYQCDANT
CSNGGTCYDSGDTFRCICPPEWKGSTCNTARNSSCLLNPCMNGGTCVGSGDSFSCICKDG
WEGRTCTQNTNDCNPHPCYNGGICVDGVNWFRCNCAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYQCICPPGRAGQRCQEVIRFGKSCWSQGMPFPHGSKWTEECNTCHCMDGRIE
CSTVWCGRKPCLLPKHPDYTENQCPRGQDCLERAYPKCLQPPCAAWGECSPVEPLVPSTP
CQPNSGHLGNNCAKITLIFNRDKIPQGTTVGAICAGIRYLPATRAAAQEGLLVLLCDLSA
STENAVEVAISFSPPRDEPDNILIQNAANTIVSAITKPENSTVLLAVTEVKVETVVMGNS
STDYLVPILCGVFSIMWLTCIIICVWWTRKRRKERERSRLPREESVNNQWATLNPIRNPI
DKPYSNKDIYYECKNFISPPKRTHDEVEEYVEYEEEEDEEEEEEGEREVIEVEKFLSPKL
QKSSLTKGPGDFKESPLGKWAHPGASHKVDNRSLKNVNDYEDGKD
Download sequence
Identical sequences G3VAT1
ENSSHAP00000000285 XP_003756492.2.9362 ENSSHAP00000000285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]