SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VCW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VCW4
Domain Number 1 Region: 894-1009
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.98e-20
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 537-659
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000206
Family Regulator of G-protein signaling, RGS 0.0027
Further Details:      
 
Domain Number 3 Region: 723-850
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000486
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 
Domain Number 4 Region: 267-388
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000013
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3VCW4
Sequence length 1139
Comment (tr|G3VCW4|G3VCW4_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000001018} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MSLNREQSIQWIKKERLPAFLESDCYFEYRLAKLISQVRWSRSGMKMHIDSLYRPWVTKK
LEAPPPSIAEDENELLMKKYYISLGEATFTQTQDWFTMAKQSQATVTTFSSPTSIISSRI
QEKAFEGDNIFDEPMKKDSSIDPGSSSETLNEKGFLSVKDSPSHALLRIYLERQEVSQDL
ELFFTTFEEFITAYINFIMKSALAKLVQRPLKEEVINFNNVSQVVIQAPKENVERKISHF
SVDIKKNEFDENVELVSLCSRTESIGVDARADWCLSHKTYDIGTRKEFERFKKFIKGTLG
ERYRWLWMDIERLKVLRDAGRRQRHLEKMRKCYLVSTGECYLTPEVLIKLNLIDGSFWNE
PHLRCIQADVVKPLLQYWGPRFCVTHKYEIKNASAELKFWHSRQEQPRKDIDPFPQMVTL
LPLRPKSCMPQISTLKKEDFIQLRSLKSARKSLKKSERAGSATFRKSSGKSEAPDEIAEQ
ELTGKSSKCMTISSKVIRLTSFTDISECLKPQLDRKFSYTEETTVKKAPADAALFGSEME
NLLQSLFVENRAGYFFTKFCERSENKLWKNSAYFWFDLQAYHQLFYQETLQPFKVCKQAQ
YLYAMYVAPSATLDIGLEKKKKKEIYMKIDPPFEDLFDAAEEYILLLLLEPFKEMVKSDQ
INYGQVELLQQNRQLDSWYLRKLQAMHRESTPKTEEEPVLDLPLPYIPKETQLWNKVPKE
FRHLNFNYLLTNKLEFEHFRQFLASHSASMDLMCWTDIEQFRRILHQDKKQREAKSIEIK
NKYLNKKYFFGPNSPATKEQQDEIMQLGGGWGMILHDQLASPVLLEIQKCVQRRLENMWL
PLFLSCEQFAARQKIKLQMEDIAEEFILKKRGEKIGVWKPEESKWISSSTDIIAFRKALL
NPLLAKLFQQFVSLKGELLGNGVLFWQEVQKYKDLCHSHCEDAVIQNKITTIINCFINSS
VPPALQIDLPFDQAQKIIEHRKELGPYVFREAQMTIFGVLFKYWPEFCQFQSNLTDEKVM
STLERRKEFKKKQATSIEDSKTKDASRTASGSVSGSGRISSTTGLNMQAYNRQPSWCYSK
YIEALEQERTLLKIQEDLEKKITTNNSAGPSSTNKAFVSSSLHMNVTKCKVLEDQQGET
Download sequence
Identical sequences G3VCW4
ENSSHAP00000001018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]