SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VDH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VDH3
Domain Number 1 Region: 187-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.028
Further Details:      
 
Domain Number 2 Region: 117-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VDH3
Sequence length 436
Comment (tr|G3VDH3|G3VDH3_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000001227} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=NPNT OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MDFLLGLVIASAFYPEAAAEFDGRWPRQIVSSIGLCRYGSRIDCCWGWARQSWGQCHPVC
QPRCKHGECIGPNKCRCHPGYSGKTCNQDDHPYPTPLDQHSEQPNVHLLDLHAMNLPSRD
LNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALSCSMANCQYGCDVMKGDV
RCRCPSPGLQLGPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGK
YQCHDIDECSLGQYQCSSFARCYNVHGSYKCKCRDGYRGDGINCIYIPKVMIEPSGPIHI
SKGNSTFPKGNGGHINTIPDIASTRWPPRTPHIPIIHTERSTPKPLRPTLKPTTQPPPTT
TELITVRMTPPPPPPAVATQRPTLKPSTMAPSFSTKIPIESTSSREMMVDNRIPVDPQKP
RGDVFSIFLENVFSRV
Download sequence
Identical sequences G3VDH3
ENSSHAP00000001227 ENSSHAP00000001227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]