SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VE46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VE46
Domain Number 1 Region: 237-350
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000542
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VE46
Sequence length 366
Comment (tr|G3VE46|G3VE46_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000001450} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
TNDKQKDTYLSLLLVLKATHLQEGSSVLILCNMNIKSLMNLSVWHPKQSTTRREILSRMQ
KVALFKIQSYWLPNFYIHCKINMAKEEECQALLQEYEERLASISSDLPLKMSIRRLYVTR
KPYCSKKIKKKMWRFIEQGTWTVESELPLIHTLHPPKSKFPPPKLVVHVGALRPLRPLRF
KDSLDNLKVKESITSTIFSSKVDTKTFRPFSLEGVCEKKFTAKLRNSTPVINYPSRLSLK
KVIKKSCSFEYLHWALTADSYAGNPFGDYLKSKHYKMENRLLRFWKDLDNFLTICISAKK
GGNLLFRHTLGNRICELYLSEDNGSTLPLKPQTIQHLKQLLPSGNAIPWIPTAQKEICKV
SCSAMK
Download sequence
Identical sequences G3VE46
ENSSHAP00000001450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]