SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VGV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VGV7
Domain Number 1 Region: 347-575
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.6e-44
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 72-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000275
Family LIM domain 0.003
Further Details:      
 
Domain Number 3 Region: 130-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000556
Family LIM domain 0.0051
Further Details:      
 
Domain Number 4 Region: 180-280
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000046
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 39-69
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000779
Family LIM domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VGV7
Sequence length 576
Comment (tr|G3VGV7|G3VGV7_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000002411} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MDGLGRENGRTPPCHLSVLKLNHKPQGQDGGWFCLPRGSDLPVCSSCGQSIFDGQYLQAL
NADWHSDCFRPRCCECGASLSHQYYEKDGQLYCKKDYWVRYGESCHGCSEQITKGLVMVA
GDQKYHPECFICLTCGAFIGDGDTYALVERSKLYCGHCYYQMVVTPVIEQILPDSPGSRL
PHTVTLVSIPASADGKRGLSVSIDPPYGQHGSGSEHSHTVRVRGVDPDCISPDVKNSIHI
GDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTIEHDPHDVLAHGTVPEASPLADLQSP
LCSPAQTPTTEAGGPVRQRPVLRSCSIDKSPCGSSLGSPASQRKDLGRSESLRIVSRTHR
IFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKESMGITERR
PLTLEPKAERISTAILFISLGKNLLMGGLEGGAWGSQQESQKDSQYPWSQRVSFAKDIAS
GMAYLHSMNIIHRDLNSHNCLVRENKTVVVADFGLARLMVDEKSQPDQLQSLKKPDRKKR
YTVVGNPYWMAPEMINGHSYDEKVDVFSFGIVLCEV
Download sequence
Identical sequences G3VGV7
ENSSHAP00000002411 ENSSHAP00000002411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]