SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VH69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VH69
Domain Number 1 Region: 118-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000404
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3VH69
Sequence length 185
Comment (tr|G3VH69|G3VH69_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000002523} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=LOC100924944 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
AEYFYEFLSLRSLDKGIMDDPTINIPLLGSVPHKASVVQVGFPCLGKQDGVAAFEVNVII
MNSEGNIILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCKCTDGFYGPHCEKALCMP
RCMNGGLCVTPGLCICPPGFYGVNCEKANCSTTCFNGGTCFYLGKCICPPGLEGDQCEKI
TSYCS
Download sequence
Identical sequences G3VH69
ENSSHAP00000002523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]