SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VJB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VJB4
Domain Number 1 Region: 30-143
Classification Level Classification E-value
Superfamily PH domain-like 6.92e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000369
Further Details:      
 
Domain Number 2 Region: 240-320
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.96e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 419-478
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000235
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VJB4
Sequence length 489
Comment (tr|G3VJB4|G3VJB4_SARHA) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSSHAP00000003269} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=WAS OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MSRGPRGSGGAPQQQNVPSGLLQDHENQRLFGLLGRKCWTLATSVAQLYLAPPSMGGRWH
KELSGAICFVKDNPRRSYFIRLYGLQEGRLLWEQEIYTQLVYSAPTPFFHTFPGDDCQAG
LNFADETEAQAFRALVEEKIQKRSQKQNAGEKGALPFTYIPFTTERRGGSTPLPSQPSGD
LSVPASTLGSPSLGLVAVDIQNPDITSSRYRGLPAPTPSPPDKKRSGKKKISKADIGAPS
GFKHVSHVGWDPHSGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEA
VREEMRRQGPQRPPPSTTPGVTNPVDIEAGPQRLLLARLNSSSSCPSLPLLEGPVPPPPP
PSRAGAPQRSPGSSVAGSRGGRSGPLPPVPSGTGGIPSVPPPVPXSWGGSAAAAPAPRGR
GALLEEIRQGIQLNKTPGAQEIPAPPPPSSEGLVGALMHVMQKRSKVIHSSDEGEDQGGE
EDEEDEWED
Download sequence
Identical sequences G3VJB4
ENSSHAP00000003269 ENSSHAP00000003269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]