SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VLW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VLW9
Domain Number 1 Region: 512-638
Classification Level Classification E-value
Superfamily TIMP-like 1.61e-25
Family Tissue inhibitor of metalloproteinases, TIMP 0.037
Further Details:      
 
Domain Number 2 Region: 338-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 268-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 4 Region: 401-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 92-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000276
Family APC10-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VLW9
Sequence length 638
Comment (tr|G3VLW9|G3VLW9_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000004174} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=LOC100920534 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MAALGLALILLLESAVSGSGEAGKFHTFRCDHHACNPPVGNLATGRIPITFTTCGESGTE
LSCFYVDQPALPSNTLNCGHLQCTKCNAQQPNNSHPPSSMTDNVFITPSTWWQSAPGISR
EEVRLDFETEFYLTHVIVVFKSPRPAAMILERSQDGGHTWRPYKYFATNCTATFGLQDDL
TEEGSLCTSRYSDAIPCTRGEVIYRALTPTNQIADPYGPEAQDLLKLTNLRLLLLKRQDC
PCQGMRLLEKPQRFTHYAIYDLIVRGSCFCNGHGEMCRPVEKFQPGKKEGKRYLVHGACV
CRHHTAGLHCEKCLPLYNDQPWKPGDGKTNQPNECKKCRCHNHADSCHFDEDVWLSSGKR
RGGICDNCRHHTEGRHCQKCKSGFYRDWSKPMSSPEVCKPCSCQPLGSSNETSHKGFPCH
PKTGYCLCKPGVAGPHCDRCLVGYWGFGGNGCRPCNCSGACDPHTGACLSGHTYIYIWGQ
IPDLVQGPGNDSEEPEPLRWDGQEQGFSALRHPEKCVCKEKAVGKVRDFCQMKYAYVIKA
KILSAYDKGTHAEVWVKVKKVLKSGQMKISRSHQSIYPESWTHRGCTCPILNPGTDYLIA
GQEDPKNSKLLVNMNSLVKPWKVYLGKQVTGILRTGCK
Download sequence
Identical sequences G3VLW9
ENSSHAP00000004174 ENSSHAP00000004174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]