SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VM49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VM49
Domain Number 1 Region: 81-157
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-16
Family PHD domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3VM49
Sequence length 170
Comment (tr|G3VM49|G3VM49_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000004254} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MFSPSRSSLKGSVKRQALYACSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCD
CGNSKFKNLECKLLPEKGKLNSGNKYNDNFFGLYCICKRPYPDPEDEIPDEMIQCVVCED
WFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAGNFITVFPDC
Download sequence
Identical sequences G3VM49
ENSSHAP00000004254 ENSSHAP00000004254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]