SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VMA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VMA2
Domain Number 1 Region: 180-194,310-350,379-593
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-61
Family Nuclear receptor ligand-binding domain 0.000078
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3VMA2
Sequence length 605
Comment (tr|G3VMA2|G3VMA2_SARHA) Nuclear receptor subfamily 2 group C member 1 {ECO:0000313|Ensembl:ENSSHAP00000004307} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=NR2C1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MATIEELAHQIIEQQMGEIVTDQQTGQKIQIVTALGQSTPGKQFILTNHDGATPSKVILA
RQDSTPGKVFLTAPDAAGVNQLYFATPDLSAQHIQILTDHSSSDQTPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDIRSPLAATPTFVTDNETTRSAGLLDSG
MFVNIHQSGIKSESAMLMTPDKVESCQGDLSTLASVVTSLANLGKTKDISQSSPELSMIE
SLSNGDTSLSDIQHEMQSSSDVTRAFDTLAKALNPGESAACQSSVESMEASVHLMAGEAS
MNIVEIEGPLLSDAHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALG
QENSISLVKAYWNELFTLGLAQCSQVMNVAMILAAFVNRLHNSLQQDKLSTERGKVMMEH
IFKLQEFCNSMVKLCLDGYEYAYLKAIVLFSPDHPGLENMGQIEKFQEKAYMEFQDYLTK
TYPDDTYRLSKLLLRLPALRLMSATITEELFFKGLIGNVRIDSVIPYIFKMETADYNSQI
IGHGI
Download sequence
Identical sequences G3VMA2
XP_003771084.1.9362 ENSSHAP00000004307 ENSSHAP00000004307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]