SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VMI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VMI6
Domain Number 1 Region: 71-125
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000308
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3VMI6
Sequence length 133
Comment (tr|G3VMI6|G3VMI6_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000004391} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
QQAVAERERLLQAREGTKRSKEEARPVPAIMAPPPPPPRPPGPRVLDLYQHLERWGHSPE
SCPHVRVTSGCCRGPLVKVGGRIKTWRKRWFCFDRHARRLAYYADKEETKLKGVIYFQAI
EEVYYDHLRCAFK
Download sequence
Identical sequences G3VMI6
ENSSHAP00000004391 ENSSHAP00000004391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]