SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VNX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VNX6
Domain Number 1 Region: 19-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-33
Family MBT repeat 0.00042
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.05e-29
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 380-455,483-519
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.69e-25
Family MBT repeat 0.002
Further Details:      
 
Domain Number 4 Region: 155-269
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.15e-23
Family MBT repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 791-862
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.45e-17
Family SAM (sterile alpha motif) domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3VNX6
Sequence length 867
Comment (tr|G3VNX6|G3VNX6_SARHA) Scm like with four mbt domains 1 {ECO:0000313|Ensembl:ENSSHAP00000004881} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=SFMBT1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MNGEQQFDTDAGSGVEEVEFNWDEYLEDTGSIAAPHGSFKHVDTSLQNGFAPGMKLEVAV
KSDHETYWVATIITTCGQLLLLRYDGYGEDRKADFWCDIRTADLHPIGWCEQNKKILKAP
EGIKDKISDCYEFLRETLKGAYSAPSNLLEGLHKGKNPLDLIAPGSRLECQNFQDSLSTW
IVNVADNIGGRLKLHYEGLENSDQFEQWLFYLDPFLHQVGWASQEGYALHPPTVIRHLKS
EAEWQEILTKIKEEEEESLIPSDLFKDKLVIGHHTFSVGMKLEALDPSAPFTISPATIVK
VFNEKYFLVEIDDLRAENTTRRSFVCHVNSSGIFPVHWSLKNGLHLSPPPGYPNQDFDWA
DYLKQCGAEAAPQSCFPLPISDHGFKENMKLEAVNPIDPEEVCVATITAVKGSYLWLQLE
GSKKPVPECIVSVESMNIFPVSWCETNGYQLRSPRRAVVNKQKKVAVVQPEKQIIPSRMV
HESLKNQEPNPPDSVTINGKYFCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLK
EVLTLLINAAYKPSRVLRELQLDEDSVWHGHGETLKAKYKGKSYRATVEIVRTADRVTDF
CRKTCIKLECCPNLFGPQMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLEC
VMKKTNKRRKRRKNFFVHKKKRSSTSVDNTPAGSPQGSGCEDDDDQDEVDEESLSEDSAS
EQQDELQEESEVSEKKSCSSSPTQSELSHSLAQERDKRKRKLRTFSFSDDENKPPSPKEI
KIEVAEKLQLDSNPLEWSVADVVRFIKSTDCAPLARIFLDQEIDGQALLLLTLPTVQECM
DLKLGPAIKLCHHIERIKFAFYQQFAN
Download sequence
Identical sequences G3VNX6
XP_003762609.1.9362 ENSSHAP00000004881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]