SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VQ70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VQ70
Domain Number 1 Region: 509-684
Classification Level Classification E-value
Superfamily PH domain-like 5.06e-37
Family Phosphotyrosine-binding domain (PTB) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3VQ70
Sequence length 696
Comment (tr|G3VQ70|G3VQ70_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000005325} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
GTRVGRWLLQDPSSFCPLRPPQDISLEEFDDEDLSEITDDCGIGLNYDSDPCEKDSLSLG
RSEHPHPICSFQDDFQEFEMIDENEEEEEEEDGDGVEDGGHRHEIPPSPPLIPSPSAQEP
QKPRPTTLNLTSLGTQDSLNNNGGYSPPPPATWQDTLLSSPPEESHNGERVERRTIKNEG
RCGVREGSPKPGDLFRGMAGEQRPRELWVKEGVRGAVMEGDWGTVNEGGSAVGRDLLNGR
KGLGVVGEGGEVGSPYCPAFLLAAHRGSHVCTADGHREEQCGPPSGYDCEGNRPREGSEA
SPGHPAAPGSSPDAYTPPPPPPSKSPGGGGEGGSRLYWERGPGLAWGWGLRGPASLVSQR
RQSRPKVLSTVSSTKLRAWTQDEENMGRTGVQQGFHIQFNSRFGILQCTPNSGAGGEKGD
LGSVSGGPSPGTSSSSPPPASFTVSLPPSLYLSFSSSPNSGTESFGLFSCVINGEEREQT
HRAVFRFIPRHADELELDVDDPVLVEAEEDDFWFRGFNMRTGERGIFPAFYAHAVPGPTK
DLLGGKRSPCWVERFNVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPASCDLQ
ISLRGVKLSLSGGGPEFERCSHFFQMKNISFCGCHPRNSCYFGFITKHPVLSRFACHVFV
SQESMRPVAQSVGRAFLEYYQEHLEYACPTEDIYLE
Download sequence
Identical sequences G3VQ70
ENSSHAP00000005325 ENSSHAP00000005325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]