SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VQY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VQY8
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.41e-54
Family D-ribulose-5-phosphate 3-epimerase 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VQY8
Sequence length 187
Comment (tr|G3VQY8|G3VQY8_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000005593} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
HFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENP
GALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVH
WLRTQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAA
QKRSLDR
Download sequence
Identical sequences G3VQY8
ENSSSCP00000017113 ENSSHAP00000005593 ENSSSCP00000017113 ENSSHAP00000005593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]