SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VSY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VSY3
Domain Number 1 Region: 6-38,88-156
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-22
Family Voltage-gated potassium channels 0.0058
Further Details:      
 
Domain Number 2 Region: 164-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000353
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VSY3
Sequence length 370
Comment (tr|G3VSY3|G3VSY3_SARHA) Potassium two pore domain channel subfamily K member 4 {ECO:0000313|Ensembl:ENSSHAP00000006288} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=KCNK4 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
PSSGRAMRPTTLLALLALVLLYLVSGALVFRAFEMPKEQQAQSSLGKTRENFLREHPCVN
LSVLQAFIEQVANDLSMGADPGDLTNVSRTAWNLGSAFFFAGTIITTIGYGNMVLLTDEA
RIFCIFYALVGIPLFGMLLAGVGDKLGSSLRRGIGHVEAIFLKWKVQPALVRSLSAMLFL
LVGCLLFVLAPMFVFRYIEGWSTLEALYFIIVTLTTVGFGDFVAGGAREGGSRPFAPGAA
ARRGRAGARQLEQRGALGARGRGGPPPTATPPPPLPEKPKSGPPPTPPAKPGAGPPSLEK
AKPPSSAPTSSVSAPLDYPGENFAFIDESSDTQSERGSVLPRSRRAGLKQPRKPARPRHS
RHGPDKRELA
Download sequence
Identical sequences G3VSY3
ENSSHAP00000006288 ENSSHAP00000006288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]