SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VTD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VTD1
Domain Number 1 Region: 1132-1359
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-37
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 642-780
Classification Level Classification E-value
Superfamily Cadherin-like 1.95e-33
Family Cadherin 0.00063
Further Details:      
 
Domain Number 3 Region: 220-332
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 539-646
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-28
Family Cadherin 0.00092
Further Details:      
 
Domain Number 5 Region: 114-218
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-26
Family Cadherin 0.00077
Further Details:      
 
Domain Number 6 Region: 9-112
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 325-442
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-25
Family Cadherin 0.0007
Further Details:      
 
Domain Number 8 Region: 1381-1563
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.7e-25
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 9 Region: 442-543
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 804-906
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.0093
Further Details:      
 
Domain Number 11 Region: 2148-2406
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000787
Family Rhodopsin-like 0.034
Further Details:      
 
Domain Number 12 Region: 1072-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000469
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1583-1616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000163
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 14 Region: 1712-1752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VTD1
Sequence length 2555
Comment (tr|G3VTD1|G3VTD1_SARHA) Cadherin EGF LAG seven-pass G-type receptor 1 {ECO:0000313|Ensembl:ENSSHAP00000006436} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=CELSR1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
RRGAAGGTSPQFQLPSYQVSVPENEPAGTPVIELRAQDPDEGEAGRLTYQMEALFDERSN
GYFHIEPDTGAVTTSRPLDRETKDTHVLKVTAVDHGSPQRSGATYLTVTVSDTNDHSPVF
EQVEYRETVRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGADGAFEIDPRSGVVRTRS
VVDREEVAEYQLLVEANDQGRNPGPRSATATVRILVEDENDNYPQFSEKRYVVRVPEDVA
VNTPILWVQATDRDQGQNAALHYSIVSGNLKGQFYLHSLSGGLDVINPLDFEAIREYTLR
IKAQDGGRPPLINSSGLVNVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDAD
SGENARLHYRLVDVTTGAGADADASARTDFPFQIHNSSGWITVCAELDREEVEHYRFGVE
AMDHGSPVMSSSASVAITVLDVNDNDPVFTQPVYELRLNEDATVGSSVLTLQARDRDANS
VITYQLTSGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLGVTASDGTRSHTAQVFIN
VTDANTHRPVFQSSHYTVSVREDQPVGTSIATISATDEDTGENARITYVLEDPVPQFRIH
PDTGTIVTLMELDYEDQAAYTLAITARDNGIPQKSDTTSLEILILDANDNVPHFLRDFYQ
GSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGEDGDGDFYIEPTSGVIRTQRRLDR
ENVAVYNLRALAVDRGSPAPLSASVEIQVPVLDITDTPPVFDQDELELFVEENSPVGSVV
ARIRAXSAPLVSRATVYVRLVGQNDNPPGLPDFQVLFNNYVTNKSNSFPTGVIGRIPAHD
PDLSDSLNYTFLQGNELNLLLLNSDTGELQLSRDLDNNRPLEALMEVSVSDGIHSVTALC
TLRVTIITDDMLTNSITVRLENMSQEKFLSPLLSLFVEGVAAVLSTTTDGIFVFNVQNDT
DVSSNILNVTFSALLPGGVRNRFFPSEDLQEQIYLNRTLLRMISTQRVLPFDDNICLREP
CENYMRCVSVLKFDSSAPFISSTTVLFRPIHPISGLRCRCPPGFTGDYCETEIDLCYSNP
CGGNGLCRSREGGYPCDCHPDYTGEFCEVNARSGRCAPGVCKNGGRCVNLLVGGFKCECP
PGEYEKPYCGVSTRSFPAQSFVTFKGLRQRFHFTLSLTFATRERNALLLYNGRFNEKHDF
LALEIIEEQIQLTFSAGETRTTVAPLVRGGVSDGQWHSVRVQYYNKPHIGRLGIPHGPSG
EKVAVVAVDECDTAVAVRFSGLLANYSCAAQGTQTGSKKSLDLTGPLLLGGVPNLPEDFP
VHNRQFIGCMRNLSIDNQAIDMESFIANNGTRAGCAAQENHCQRIWCQNGGTCVNKWNTY
ICDCPLRYGGKNCEQAMPHPQRFSGESLVFWGDLDITISVPWYLGLMFRTRKGSGTLLEA
SAGPSSKISLQILNSHVDFAVFHGPSEVASMRLGRSRVSDGRWHHLLIELRSAKDGKDIK
YLAVMTLDYGLDQNTVQIGNQLPGLKMRSLLVGGLSEDQVTVRQGFSGCMQGVRMGETST
NIVTLNMKEALKVRVKDGCALDNPCASSPCPEHSHCTDDWDSYSCTCDPGYFGRDCVDVC
NLNPCEHVSTCVRKPSSAQGYACECGQSYYGQYCENKIHLPCPKGWWGNPVCGPCHCEVS
KGFDPDCNKTNGECQCKENYYKPQHQEACYPCDCFPYGSHTRTCDMETGQCACKSGVIGR
QCNRCDNPFAEVTTQGCEVIYSGCPRAFEAGIWWPQTKFGQPAAVPCPKGSVGNAIRHCS
SEKGWLPPELFNCTTSSFLGLRTMNEKLRRNETRMDGDKSIRLMHVLENVTRSAGVLYGN
DVRTAYHTMLHVLQYESRQQGFDLAATRDAEFHEVRDGGAEKWGLGGLGDPEKQRLVIAF
NGPRRASAKHLSSRHLQRKAPPNKWRSPHQCFVVPSQPPSPGSEKAAPAPRFSSPRGTES
GPSPRVLAGPQRESRGGVSPVPLAGTEPLPGPHQGSSHLGRGGRRAETLQAGRAPGPWGP
RAEIRGKLPRGSSRTKARVGDKPPAPRPGLRSLPRAPEQWLVNVSRPPESGWERAGPPAG
PGLVGTKICYVKYNYNIRYEYNYNDMLHIGIIIIIYVRQHGEVLPLKIVTYTSVSISLVA
LLLAFVLLLLLRTLRANLHGIHRNLIAALFSSQLVFVIGIDQTENPFTCTVIAILLHYFY
LSTFAWLFVEGLHVYRMLTEVRNIDSGHMRFYYVLGWGIPAVVTGLAVGLDPQGYGNPDF
CWLSVHDTLIWSFAGPIGIVVTLNTIIFVLSARASCRRKHRTYDRSGITSSLRTAFLLLL
LISATWLLGLMAVNSDVMAFHYLFAVFSCLQGLAIFFFHCVLNKEVQKHLKVTLMGKKPH
PDDSTTTRATLLTRSLNCNNTYIEEPNMYRTELGESTASLDSAVSSGAVQPEWTPVLRLG
DCVARPGKGPVLSGPLGLGRNGKSPRGNDSDSDSELSLEEHSSSYASSSDSEEDGVDEEN
KWAPGSCKTNDRGPIHSTPKDGSPGNGQLLWGSSF
Download sequence
Identical sequences G3VTD1
ENSSHAP00000006436 ENSSHAP00000006436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]