SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VTH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VTH4
Domain Number 1 Region: 158-228
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.42e-25
Family PHD domain 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VTH4
Sequence length 230
Comment (tr|G3VTH4|G3VTH4_SARHA) Inhibitor of growth protein {ECO:0000256|RuleBase:RU361213} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ING5 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
VSGIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKNLSPEQRVEHLQKIQN
AYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKEKMEGSDLESSGGRGLKK
GRGQKEKRGSRGRGRRTSEEDTPKKKKLKGGSEFAETILSVHPSDVLDMPVDPNEPTYCL
CHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Download sequence
Identical sequences G3VTH4
ENSSHAP00000006479 ENSSHAP00000006479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]