SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VTU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VTU8
Domain Number 1 Region: 39-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.82e-47
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 489-585
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-18
Family PDZ domain 0.000021
Further Details:      
 
Domain Number 3 Region: 415-453
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000841
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VTU8
Sequence length 706
Comment (tr|G3VTU8|G3VTU8_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000006603} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
VGAEGLILPEFPLTGQFRYKRRVYTQSLLDDKQFAKLHTKANLKKFMEYVQLHSTEKVAR
LLDKGLDPNFHDPDTGECPLTLAAQMDSATDLLKVLRNGGAHLDFRTREGLTALHIATRC
RNPGALTTLLDLGASPDYKDSRGLTPLYHSALGGGDPLCCELLLHDHAQIGTADENGWQE
IHQACRFGHVQHLEHLLFYGADMRAQNASGNTALHICALYNQESCARVLLFRGASKDVRN
YNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETPSYTKRRRLAGPSGLASPRPLQRS
ASDNDLKAEARSGPSPGPSLRSLPHQLLLQRLQEDKERDKDPTVHTLVRGGRSKSSSHSP
CSPCSPCSPCKPPSPCSPQDASAPPRGPGCCYLGEGPGARGVAVSGSVPGGWGGIHEKDS
LPVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQYDTRHETREDRTKRLFRHYTVGSYD
SLTSHSDYVIEDKVAVLQKREQEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDYEG
VAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLLMKVVSVTRKPEEEGARRRA
PPPPKRAPSTTLTLRSKSMTAELEELEKLDEILAAAAEPTLRPDIADADSRAATVKQRPT
SRRITPAEISSLFERQGLPGSEKLPGSLRKGIPRTKSVGMAMADSK
Download sequence
Identical sequences G3VTU8
ENSSHAP00000006603 ENSSHAP00000006603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]