SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VV74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VV74
Domain Number 1 Region: 132-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000768
Family EGF-type module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VV74
Sequence length 243
Comment (tr|G3VV74|G3VV74_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000007079} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=AREG OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MRAQPPPPQRTTSLLFLYLLVLSAVCHHVAASDAKDTSYPEKNDLFSGDHNPDGLELFTV
SEISSTSEISSGTEYDYYEEYEEEDPQLSGYVLDDSIRVGRLVKPKKNRTESEKNSSKTG
RKKFKNRKRKQKKINPCDGEYKNYCIHGECKYIESLEAVTCNCHQDFFGERCGEQSMKTH
SLGDGGSSITALAIVAAILSVLCFSAIVLITKQIWKAHYSIRDQETEERKHLKRENKNGI
ISV
Download sequence
Identical sequences G3VV74
XP_012408434.1.9362 ENSSHAP00000007079 ENSSHAP00000007079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]