SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VVV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VVV9
Domain Number 1 Region: 272-434
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.42e-40
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 4-121
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.82e-29
Family PWWP domain 0.0016
Further Details:      
 
Domain Number 3 Region: 433-555
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 4.65e-28
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VVV9
Sequence length 557
Comment (tr|G3VVV9|G3VVV9_SARHA) Glyoxylate reductase 1 homolog {ECO:0000313|Ensembl:ENSSHAP00000007314} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=GLYR1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MATVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQL
KPYHPHKEEMIKINKGKRFQQAVDAVEEFLKKAKSKDQSVFLQSSHNSAEEKNRRNSSEE
RSKQNSGDEKRKAGLSEGKVRKNMGEGKKRVSSASAERGSKSPLKRAQEQSPRKRGRPPK
DEKDLTIPESSTVKGMVAGTMAGFKWQPSVSEPVKDGDPHFHHFLLSQTEKPAVCYQAIT
KKLKVCEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVW
NRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKC
YVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSC
FQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDSVNHPTPMAAAANEVYKRAKA
LDQSDNDMSAVYRAYIH
Download sequence
Identical sequences G3VVV9
ENSSHAP00000007314 ENSSHAP00000007314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]