SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VWF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VWF5
Domain Number 1 Region: 75-204
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-45
Family Regulator of G-protein signaling, RGS 0.00000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3VWF5
Sequence length 236
Comment (tr|G3VWF5|G3VWF5_SARHA) Regulator of G protein signaling 18 {ECO:0000313|Ensembl:ENSSHAP00000007510} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=RGS18 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MEKPLVFFSQLTMSDSKEKNFYKVIHAIGKEALNKDIKNRNKEKRNRLSLLLQKPEFHEN
VNLGGSSENLAKGTSVSPEEAVKWSESFDKLLSHKDGFDAFTRFLKTEFSEENIEFWAAC
EDFKKSQEPHQLFHKAQAIYEKFIQNDAPQEVNLDFHTKETIFKSISQPTIHSFDAAQSR
VYRLMEQDSYTRFLRSDIYLDLINGRPLRTTNLRRRSRSFTFNEFPAEKSDIAIWL
Download sequence
Identical sequences G3VWF5
XP_003767578.1.9362 ENSSHAP00000007510 ENSSHAP00000007510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]