SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VXN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VXN0
Domain Number 1 Region: 174-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000362
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 119-266
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000722
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VXN0
Sequence length 540
Comment (tr|G3VXN0|G3VXN0_SARHA) Oncoprotein induced transcript 3 {ECO:0000313|Ensembl:ENSSHAP00000007935} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=OIT3 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
SEVLCCLIHLCEPLVPLDPCSAYISLNEPWRNTDHQLKEEEGQPTCDSNVDGEWYRFTGM
AGDAMPTFCIPENHCGTHAPIWLNGNHPQEADGIVQRQACASFNGNCCLWNNTVEVKACP
GGYYVYRLTKPSVCFHAYCGHFYDICDVVDCHGTCSNSECTCSEGTVLGPDQQTCLDENE
CEKNNGGCSEICVNLKNSYRCECGVGRVLGSDGKTCEDIEGCQNKNGGCSHFCRGYGNTY
QCECPRGLVLSEDNHTCQVPMRCQSNAIEVNIPKDLVGGLEVFLTNTSCRGVSNGTHINI
YFSLKTCGTVVDVVNDKIIASNLVTGLPKQMPGSNGDIIIRTSKLLIPVICEFPRLYTIS
EGYVPNLRNSPLEIMGRSQGIFPFTLEIFKDNEFEEPYRETLPTLKLRDLLYFGIEPLVH
VNGLETLVESCFATPTDKIDEILKHYLIRDGCVSDDSVKQYTSRDHLTKHFQVPVFKFVG
KDHQVVFLHCRVLVCGVLDEQSRCAQGCNRRMRREAIKEQGAHLQNHVLTSGPIIIDRED
Download sequence
Identical sequences G3VXN0
ENSSHAP00000007935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]