SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VZ19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VZ19
Domain Number 1 Region: 154-301
Classification Level Classification E-value
Superfamily EF-hand 2.04e-52
Family Osteonectin 0.000000108
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.0000361
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VZ19
Sequence length 303
Comment (tr|G3VZ19|G3VZ19_SARHA) Secreted protein acidic and cysteine rich {ECO:0000313|Ensembl:ENSSHAP00000008424} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=SPARC OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MRAWIFFLLCLAGRALAAPQQQEALPDEAEVVEEPVPEVTEGPVGANPVQVEVGEFDETV
DEAEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPVGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELSEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLKVKKIHENEKRLEAGDHPVELLARDFEKNYQMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFEACDLDNDKYIALDEWAGCFGIKDQDIDKD
LVI
Download sequence
Identical sequences G3VZ19
XP_012407340.1.9362 XP_012407343.1.9362 ENSSHAP00000008424 ENSSHAP00000008424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]