SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VZT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VZT7
Domain Number 1 Region: 416-520
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.05e-29
Family MBT repeat 0.0009
Further Details:      
 
Domain Number 2 Region: 291-392
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-28
Family MBT repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 181-288
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-23
Family MBT repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3VZT7
Sequence length 521
Comment (tr|G3VZT7|G3VZT7_SARHA) L3MBTL2, polycomb repressive complex 1 subunit {ECO:0000313|Ensembl:ENSSHAP00000008692} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=L3MBTL2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
SERMEEEEEEDDDDEEEEEEEEELDLFGGYDSFRSYNSSLGSESSSYLEESSDNENELND
REAGELPTSPLLIPSPNTPRSQDGSGSEPAVCEMCGIVGTREAFFSKTKRFCSVSCSRSY
SSNSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAFLHSQGTGQLADGTPTGQDALVLG
FDWGKFLKEHNYKAAPVSCFKHVPLFDQWDDVVKGMKVEVLNNDAVLPSRVYWIASVIQT
AGMRRALLGSRHLSQDFWCNLGTVDVHPIGWCAINSKILVPPQTIHAKYTDWRSYLMKRL
VGARTLPVDFHIKMAESMKYPFRQGMRVEVVDKTHVSRTRMAVVDTVIGGRLRLLYEDGD
GDDDFWCHMWSPLIHPVGWSRRVGHSIKKPGGESTARPEPTPLPLPLPKVRAVYTEGGWF
EEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICIDGSPSVDDSDWFCYHASSHAIFPAT
FCQKNAIDLTPPKGYDPKTFDWASYLEETNSKAAPARLFNM
Download sequence
Identical sequences G3VZT7
ENSSHAP00000008692 ENSSHAP00000008692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]