SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W008 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W008
Domain Number 1 Region: 263-415
Classification Level Classification E-value
Superfamily FAS1 domain 6.54e-28
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 2 Region: 431-571
Classification Level Classification E-value
Superfamily FAS1 domain 1.23e-24
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 3 Region: 72-199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000314
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 197-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3W008
Sequence length 732
Comment (tr|G3W008|G3W008_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000008763} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MGKRSMHIGCQTKCVKTVITRECCAGFFGPQCQLCPGKVGNACFGNGICLDGVNGTGVCE
CEGRFSGTACETCMEGIYGSNCDQVCSCVHGRCSQGPNGDGSCECEVGWRGVKCDTEIKK
DDCNNTCHTSANCLLNSSGTAYCKCAAGFQGNGTVCTAIDACETSNGGCSTKADCRRTTP
GNRVCVCKAGYTGDGIVCLEINPCLENNGGCDRNAECTQIGPNQAACNCLQGYTGDGKTC
TLINICLTRNGGCNELAICNQTGVDERTCTCKPGYEGDGFTCRGPIYLELPKNTDTIPYF
FHLQENAIRDLMGPGPFTVFVPWKEALENASQTQVKEWITQGVMPQVLRYHVVACQKLLL
ENLKLIPSMTSLQGETIHINVSQDMVYVNGNAKIVSSDIICSNGVIHIIDQILVPKKLQE
IRKDASGNNAKDIISVAVQQGYLKFASMLQDTGLLSFINDPVHKPVTLFWPTDKALKDLP
QEQQDFLFGKDKDKLKQYLKFHIIRDSKILAVDLPSVASRKTLQGSELNVRCGDENNIGD
LFLNDQKCRIVQRQLEFDSGIAYGIDCMLINPSFGGRCDSFVTFNVSGECGSCYNIPRCP
TWSKPKGVKQKCFYHLPFRRNLEGCQQKCTMVMRLPKCCKGYFGRDCQACPGGSTTPCNN
RGVCIDEYFGDGECKCNTGFNGTACELCWPGRYGPDCKSCECSEHGTCDEGITGSGNCFC
ETGWTGRFCDTQ
Download sequence
Identical sequences G3W008
ENSSHAP00000008763 ENSSHAP00000008763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]