SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W0W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W0W0
Domain Number 1 Region: 74-187
Classification Level Classification E-value
Superfamily DNA-binding domain 8.17e-33
Family Methyl-CpG-binding domain, MBD 0.000000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3W0W0
Sequence length 492
Comment (tr|G3W0W0|G3W0W0_SARHA) Methyl-CpG-binding protein 2 {ECO:0000256|PIRNR:PIRNR038006} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=MECP2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
EILGLLDFREEQSEDQDLQGLRDKPLKFRKLKRDKKEEKEGKHEFPQPSSHQSAEPAEAG
KAETSEEAGSAPAAPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKSKSPK
APGTGRGRGRPKGSGTVKPRATASEGVQVKRVIEKSPGKLLVKMPFQPSPGGKAEGGGAT
TSTQVMVIKRPGRKRKVESEPPVIPKKRGRKPGSMVTAAAVEAKKKAIKESSIRSIHETV
LPIKKRKTRETVSIEVKEVVKPLLVSTVGEKSGKGLKPGKSPGRKSKESSPKGRSGSTSS
SPPKKEPQQQQYHHHHYYPSSESPKALPLPHPEPESSKDSKSPPEPQDLSSKVCKEEKMP
RGGPPESDGCTKEPAKTQPPAAAATTAATTAAAEKFKHRAEGDRKDIVSSSMPRPNREEP
VDSRTPVTERVS
Download sequence
Identical sequences G3W0W0
ENSSHAP00000009065 ENSSHAP00000009065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]