SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W1D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W1D3
Domain Number 1 Region: 391-555
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000483
Further Details:      
 
Domain Number 2 Region: 569-692
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-20
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 684-768
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-16
Family PDZ domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3W1D3
Sequence length 775
Comment (tr|G3W1D3|G3W1D3_SARHA) Amyloid beta precursor protein binding family A member 1 {ECO:0000313|Ensembl:ENSSHAP00000009238} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=APBA1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MSHVEGPPDVEVTDEPGSGESGEVNESVEADLEHPEAEEEQRLQPQHATPYPGDPVQGTR
GPQPVQGLEEEDRGSSLARSASTESGFHNHTDTAEGDIIAASAEDGYDPERAQENEDESA
YAVQYRPEAEEYTENAEAEHAEASHRRXLRLYQREREEVDSYRKEALGARLHHYDERSDG
ESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQNLDGAP
SPEDGCGNADELGSPGQPAPVGPGPAVLTGEVGQRYSKEKRDAISLAIKDIKEAIEEVKT
RTVRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPADGDSPSPDSSSPRGAESSGRQHQQD
DLAESSGNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVR
MMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPL
RTISYIADIGNIVVLMARRRMPRSNSQDNVEASHPSQDGKRQYKMICHVFESEDAQLIAQ
SIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQ
KGEILGVVIVESGWGSILPTVILANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTC
QSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGV
RVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences G3W1D3
ENSSHAP00000009238 ENSSHAP00000009238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]