SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W4I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W4I8
Domain Number 1 Region: 146-173,211-451
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.69e-84
Family Eukaryotic proteases 0.000000186
Further Details:      
 
Domain Number 2 Region: 41-103
Classification Level Classification E-value
Superfamily GLA-domain 4.91e-25
Family GLA-domain 0.00011
Further Details:      
 
Domain Number 3 Region: 92-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000914
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3W4I8
Sequence length 453
Comment (tr|G3W4I8|G3W4I8_SARHA) Coagulation factor IX {ECO:0000313|Ensembl:ENSSHAP00000010343} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=F9 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MTDLPLLLIICCSGYFFGAEGTVFLDHKNATKLLSRPKRYNSGKLEEFIQGNLERECNEE
KCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGICKDEINSYECWCRKGYEGKN
CELDADCSIKNGGCKQFCKMNELNKVVCSCISGYQLGEDQKSCEPAVPYPCGRVSLPVTK
LTRAETFFSDMDTANSTEEEEVPDAVTQIVPFHKEDTRIVGGEDARKGQIPWQVILNGKV
KGFCGGSIINEKWVITAAHCIEPDNEITVVAGEHDTETKEGTEQTRRVIRVIPHHTYNAS
KNMYSNDIALLELEEPLKLNEYVTPICVADRKYTNLFLKLAKGTVSGWGKVFHKGRPASI
LQFLRVPFVDRATCLRSTTVTIENNMFCAGYSQGGKDSCQGDSGGPHTIEVEGTSFLTGI
ISWGERCAVKGKYGIYTKVSSFVKWIKEKTKYT
Download sequence
Identical sequences G3W4I8
ENSSHAP00000010343 ENSSHAP00000010343 XP_003774908.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]